PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009595257.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 263aa    MW: 30829.5 Da    PI: 6.5101
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009595257.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-17552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd  l++++++ G g+W++ ar+ g++Rt+k+c++rw++yl
   XP_009595257.1  5 KGPWTVEEDFTLINYIALNGEGRWNSLARCAGLRRTGKSCRLRWLNYL 52
                     79********************************************97 PP

2Myb_DNA-binding51.72e-1658101146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009595257.1  58 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 101
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.122156IPR017930Myb domain
SuperFamilySSF466894.12E-30399IPR009057Homeodomain-like
SMARTSM007173.3E-14454IPR001005SANT/Myb domain
PfamPF002491.5E-15552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-21659IPR009057Homeodomain-like
CDDcd001673.84E-10752No hitNo description
SMARTSM007171.3E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129418.70757107IPR017930Myb domain
PfamPF002494.0E-1558101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2360106IPR009057Homeodomain-like
CDDcd001678.13E-778101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MALRKGPWTV EEDFTLINYI ALNGEGRWNS LARCAGLRRT GKSCRLRWLN YLRPDVRRGN  60
ITLEEQLLIL ELHSRWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKHAKQL KCDVNSKQFK  120
DTLRYLWMPR LIERIQAAKI PSNSCSEVAQ QPGPNTNINE LEPFQLANNN NNNNNSNPST  180
SFETENSNVA PLSDLSDCCY DYPGNQISII KPDYYQVNHS NQLCYEDFQA MDQQNIQLWM  240
ESGDIFENLW NINEDMWSLE KQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-24310525126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595257.10.0PREDICTED: transcription factor MYB108-like
RefseqXP_016505593.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE19e-82MY108_ARATH; Transcription factor MYB108
TrEMBLM1A0311e-108M1A031_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000117451e-108(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-86myb domain protein 78